Name :
CDC25A (Human) Recombinant Protein (Q01)
Biological Activity :
Human CDC25A partial ORF ( AAH07401, 151 a.a. – 250 a.a.) recombinant protein with GST-tag at N-terminal.
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
AAH07401
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=993
Amino Acid Sequence :
PVRPVSRGCLHSHGLQEGKDLFTQRQNSAPARMLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGENLKNEEETPSCMASLWTAPLVMRTT
Molecular Weight :
36.63
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay， Western Blot (Recombinant protein)， Antibody Production， Protein Array，
Gene Name :
CDC25A
Gene Alias :
CDC25A2
Gene Description :
cell division cycle 25 homolog A (S. pombe)
Gene Summary :
CDC25A is a member of the CDC25 family of phosphatases. CDC25A is required for progression from G1 to the S phase of the cell cycle. It activates the cyclin-dependent kinase CDC2 by removing two phosphate groups. CDC25A is specifically degraded in response to DNA damage, which prevents cells with chromosomal abnormalities from progressing through cell division. CDC25A is an oncogene, although its exact role in oncogenesis has not been demonstrated. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations :
M-phase inducer phosphatase 1|cell division cycle 25A|dual specificity phosphatase CDC25A
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
MBL2/COLEC1 Protein
S100A9 Protein
Popular categories:
EphA2
Ubiquitin-Specific Peptidase 25
