Share this post on:

Name :
PIP5K1C (Human) Recombinant Protein (Q01)

Biological Activity :
Human PIP5K1C partial ORF ( NP_036530, 561 a.a. – 667 a.a.) recombinant protein with GST-tag at N-terminal.

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
NP_036530

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=23396

Amino Acid Sequence :
RPQEEPPAEEDLQQITVQVEPACSVEIVVPKEEDAGVEASPAGASAAVEVETASQASDEEGAPASQASDEEDAPATDIYFPTDERSWVYSPLHYSAQAPPASDGESD

Molecular Weight :
37.51

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :
Mouse (32); Rat (26)

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,

Gene Name :
PIP5K1C

Gene Alias :
KIAA0589, LCCS3, PIP5K-GAMMA, PIP5Kgamma

Gene Description :
phosphatidylinositol-4-phosphate 5-kinase, type I, gamma

Gene Summary :
This gene encodes a member of the type I phosphatidylinositol-4-phosphate 5-kinase family of enzymes. A similar protein in mice is found in synapses and focal adhesion plaques, and binds the FERM domain of talin through its C-terminus. [provided by RefSeq

Other Designations :
Human homolog of mouse phosphatidylinositol-4-phosphate 5-kinase I-gamma|PtdIns(4)P-5-kinase|diphosphoinositide kinase|phosphatidylinositol-4-phosphate 5-kinase I-gamma|type I PIP kinase

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-9 Protein
Animal-Free HMGB1/HMG-1 Protein
Popular categories:
MMP-9
Neural Cell Adhesion Molecule 1

Share this post on:

Author: calcimimeticagent