Share this post on:

Name :
TNFRSF13B (Human) Recombinant Protein

Biological Activity :
Purified TNFRSF13B (NP_036584.1 2 a.a. – 165 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.Recombinant Human Protein,Recombinant Human Proteins,Human Recombinant Protein,Human Recombinant Proteins,HuPro

Tag :

Protein Accession No. :
NP_036584.1

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=23495

Amino Acid Sequence :
SGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYS

Molecular Weight :
23.32

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Human

Interspecies Antigen Sequence :
Mouse (49)

Preparation Method :
Transfection of pSuper-TNFRSF13B plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column.

Purification :
Strep-Tactin affinity columns

Quality Control Testing :

Storage Buffer :
100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.

Applications :
Western Blot, Enzyme-linked Immunoabsorbent Assay, SDS-PAGE, Protein Interaction,

Gene Name :
TNFRSF13B

Gene Alias :
CD267, CVID, FLJ39942, MGC133214, MGC39952, TACI, TNFRSF14B

Gene Description :
tumor necrosis factor receptor superfamily, member 13B

Gene Summary :
The protein encoded by this gene is a lymphocyte-specific member of the tumor necrosis factor (TNF) receptor superfamily. It interacts with calcium-modulator and cyclophilin ligand (CAML). The protein induces activation of the transcription factors NFAT, AP1, and NF-kappa-B and plays a crucial role in humoral immunity by interacting with a TNF ligand. This gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq

Other Designations :
OTTHUMP00000065442|transmembrane activator and CAML interactor|tumor necrosis factor receptor 13B

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Thy1/CD90 Protein
CGREF1 Protein
Popular categories:
ADAMTS17
Carbonic Anhydrase 2 (CA-II)

Share this post on:

Author: calcimimeticagent