Name :
CABIN1 (Human) Recombinant Protein (Q01)
Biological Activity :
Human CABIN1 partial ORF ( NP_036427, 1 a.a. – 110 a.a.) recombinant protein with GST-tag at N-terminal.
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
NP_036427
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=23523
Amino Acid Sequence :
MIRIAALNASSTIEDDHEGSFKSHKTQTKEAQEAEAFALYHKALDLQKHDRFEESAKAYHELLEASLLREAVSSGDEKEGLKHPGLILKYSTYKNLAQLAAQREDLETAM
Molecular Weight :
37.84
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Mouse (98); Rat (98)
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,
Gene Name :
CABIN1
Gene Alias :
CAIN, KIAA0330, PPP3IN
Gene Description :
calcineurin binding protein 1
Gene Summary :
Calcineurin plays an important role in the T-cell receptor-mediated signal transduction pathway. The protein encoded by this gene binds specifically to the activated form of calcineurin and inhibits calcineurin-mediated signal transduction. The encoded protein is found in the nucleus and contains a leucine zipper domain as well as several PEST motifs, sequences which confer targeted degradation to those proteins which contain them. At least four alternatively spliced transcripts have been found for this gene, but the full-length nature of most of them has not been determined. [provided by RefSeq
Other Designations :
calcineurin binding protein cabin 1|calcineurin inhibitor
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
LRRC15 Protein
Prolactin R Protein
Popular categories:
Alpha-1 Antitrypsin 1-3
C5a Receptor/CD88