Name :
TNFRSF21 (Human) Recombinant Protein
Biological Activity :
Purified TNFRSF21 (AAH17730.1 89 a.a. – 170 a.a.) human recombinant protein with His-Flag-StrepII tag at C-terminus expressed in human cells.Recombinant Human Protein,Recombinant Human Proteins,Human Recombinant Protein,Human Recombinant Proteins,HuPro
Tag :
Protein Accession No. :
AAH17730.1
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=27242
Amino Acid Sequence :
SSCPVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQSNATCAPHTVCPVGWGVRKKGTETEDVRCKQ
Molecular Weight :
11.88
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Human
Interspecies Antigen Sequence :
Mouse (88); Rat (89)
Preparation Method :
Transfection of pSuper-TNFRSF21 plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
Purification :
Strep-Tactin affinity columns
Quality Control Testing :
SDS-PAGE and Western Blot SDS-PAGE Gel Western Blot
Storage Buffer :
100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Applications :
Western Blot， Enzyme-linked Immunoabsorbent Assay， SDS-PAGE， Protein Interaction，
Gene Name :
TNFRSF21
Gene Alias :
BM-018, DR6, MGC31965
Gene Description :
tumor necrosis factor receptor superfamily, member 21
Gene Summary :
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB and MAPK8/JNK, and induce cell apoptosis. Through its death domain, this receptor interacts with TRADD protein, which is known to serve as an adaptor that mediates signal transduction of TNF-receptors. Knockout studies in mice suggested that this gene plays a role in T-helper cell activation, and may be involved in inflammation and immune regulation. [provided by RefSeq
Other Designations :
OTTHUMP00000016561|OTTHUMP00000039915|TNFR-related death receptor 6|death receptor 6
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
HA/Hemagglutinin Proteinmanufacturer
Alpha-crystallin A chain/CRYAA Proteincustom synthesis
Popular categories:
PTH
Estrogen Related Receptor-gamma (ERRγ)
