Share this post on:

Name :
PPP2R3B (Human) Recombinant Protein (P02)

Biological Activity :
Human PPP2R3B full-length ORF ( AAH09032, 1 a.a. – 176 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
AAH09032

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=28227

Amino Acid Sequence :
MDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLESL

Molecular Weight :
45.1

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,

Gene Name :
PPP2R3B

Gene Alias :
NY-REN-8, PPP2R3L, PPP2R3LY, PR48

Gene Description :
protein phosphatase 2 (formerly 2A), regulatory subunit B”, beta

Gene Summary :
Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B’/PR61, and B”/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B” family. The B” family has been further divided into subfamilies. The product of this gene belongs to the beta subfamily of regulatory subunit B”. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq

Other Designations :
NY-REN-8 antigen|OTTHUMP00000022820|PP2A B” subunit PR48|PP2A, subunit B, PR48 isoform|protein phosphatase 2, regulatory subunit B”, beta|serine/threonine protein phosphatase 2A, 48kDa regulatory subunit B

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Ebola virus VP40/Matrix VP40 ProteinSource
Fibronectin ProteinStorage & Stability
Popular categories:
Retinoid X Receptor gamma
Ephrin-A5

Share this post on:

Author: calcimimeticagent