Name :
ZBTB7B (Human) Recombinant Protein (Q01)
Biological Activity :
Human ZBTB7B partial ORF ( NP_056956.1, 433 a.a. – 537 a.a.) recombinant protein with GST-tag at N-terminal.
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
NP_056956.1
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=51043
Amino Acid Sequence :
HLCHRAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPSTAAAFPAGLDLSNGHLDTFRLSLARFWEQSAPTWAPVSTPGPPDDDEEEGAPTTPQAEGAME
Molecular Weight :
37.29
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Mouse (90); Rat (90)
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay， Western Blot (Recombinant protein)， Antibody Production， Protein Array，
Gene Name :
ZBTB7B
Gene Alias :
DKFZp686G01254, THPOK, ZBTB15, ZFP67, ZNF857B, c-Krox, hcKrox
Gene Description :
zinc finger and BTB domain containing 7B
Gene Summary :
ZFP67 is an early growth response gene that encodes a zinc finger-containing transcription factor that binds to the promoter regions of type I collagen genes (e.g., COL1A1; MIM 120150) and has a role in development.[supplied by OMIM
Other Designations :
OTTHUMP00000035544|OTTHUMP00000035545|kruppel-related zinc finger protein hcKrox|zinc finger and BTB domain containing 15|zinc finger protein 67 homolog
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
AOC3 ProteinAccession
IL-10 ProteinSpecies
Popular categories:
Natriuretic Peptides B (NPPB)
Siglec-6
