Name :
SLC45A2 (Human) Recombinant Protein
Biological Activity :
Human SLC45A2 full-length ORF (NP_001012527.1) recombinant protein without tag.This product is belong to Proteoliposome (PL).Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength,Proteoliposome,Proteoliposomes,Membrane Protein,Membrane Proteins
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
NP_001012527.1
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=51151
Amino Acid Sequence :
MGSNSGQAGRHIYKSLADDGPFDSVEPPKRPTSRLIMHSMAMFGREFCYAVEAAYVTPVLLSVGLPSSLYSIVWFLSPILGFLLQPVVGSASDHCRSRWGRRRPYILTLGVMMLVGMALYLNGATVVAALIANPRRKLVWAISVTMIGVVLFDFAADFIDGPIKAYLFDVCSHQDKEKGLHYHALFTGFGGALGYLLGAIDWAHLELGRLLGTEFQVMFFFSALVLTLCFTVHLCSISEAPLTEVAKGIPPQQTPQDPPLSSDGMYEYGSIEKVKNGYVNPELAMQGAKNKNHAEQTRRAMTLKSLLRALVNMPPHYRYLCISHLIGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFCINSVFSSLYSYFQKVLVSYIGLKGLYFTGYLLFGLGTGFIGLFPNVYSTLVLCSLFGVMSSTLYTVPFNLITEYHREEEKEVCCH
Molecular Weight :
51.2
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Preparation Method :
in vitro wheat germ expression system with proprietary liposome technology
Purification :
None
Quality Control Testing :
Storage Buffer :
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Applications :
Antibody Production,
Gene Name :
SLC45A2
Gene Alias :
1A1, AIM1, MATP, SHEP5
Gene Description :
solute carrier family 45, member 2
Gene Summary :
This gene encodes a transporter protein that mediates melanin synthesis. The protein is expressed in a high percentage of melanoma cell lines. Mutations in this gene are a cause of oculocutaneous albinism type 4, and polymorphisms in this gene are associated with variations in skin and hair color. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations :
melanoma antigen AIM1|membrane associated transporter|membrane-associated transporter protein|underwhite
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
COMP Proteinmanufacturer
KGF/FGF-7 ProteinSpecies
Popular categories:
CD217
Gastrin