Name :
MSL3L1 (Human) Recombinant Protein (Q01)
Biological Activity :
Human MSL3L1 partial ORF ( NP_523353.1, 1 a.a. – 79 a.a.) recombinant protein with GST-tag at N-terminal.
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
NP_523353.1
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=10943
Amino Acid Sequence :
MSASEGMKFKFHSGEKVLCFEPDPTKARVLYDAKIVVVIVGKDEKGRKIPEYLIHFNGWNRSWDRWAAEDHVLRDTDEN
Molecular Weight :
34.43
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Mouse (86); Rat (87)
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,
Gene Name :
MSL3
Gene Alias :
DKFZp586J1822, MSL3L1
Gene Description :
male-specific lethal 3 homolog (Drosophila)
Gene Summary :
This gene encodes a nuclear protein and has similarity to drosophila male-specific lethal-3 gene. The drosophila protein plays a critical role in a dosage-compensation pathway, which equalizes X-linked gene expression in males and females. Thus this encoded protein is thought to play a similar function in chromatin remodeling and transcriptional regulation. This gene has been found to undergo X inactivation. There are four alternatively spliced transcript variants of this gene encoding different isoforms. [provided by RefSeq
Other Designations :
OTTHUMP00000022911|OTTHUMP00000022912|drosophila MSL3-like 1|male-specific lethal 3-like 1
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-2R alpha/CD25 Protein
MIP-2/CXCL2 Protein
Popular categories:
IL-20R alpha
CD115/M-CSF R