Name :
CD63 (Human) Recombinant Protein (Q01)
Biological Activity :
Human CD63 partial ORF (NP_001771.1, 100 a.a. – 238 a.a.) recombinant protein with GST tag at N-terminal.
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
NP_001771.1
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=967
Amino Acid Sequence :
AAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
Molecular Weight :
40.92
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Interspecies Antigen Sequence :
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,
Gene Name :
CD63
Gene Alias :
LAMP-3, ME491, MLA1, OMA81H, TSPAN30
Gene Description :
CD63 molecule
Gene Summary :
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. The use of alternate polyadenylation sites has been found for this gene. Alternative splicing results in multiple transcript variants encoding different proteins. [provided by RefSeq
Other Designations :
CD63 antigen|CD63 antigen (melanoma 1 antigen)|granulophysin|lysosome-associated membrane glycoprotein 3|melanoma 1 antigen|melanoma-associated antigen ME491|melanoma-associated antigen MLA1|ocular melanoma-associated antigen|tetraspanin-30
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Aminopeptidase A Protein
BCMA/TNFRSF17 Protein
Popular categories:
Serpinb3a
Dendritic Cell CD Proteins