Share this post on:

Name :
PKIG (Human) Recombinant Protein (P01)

Biological Activity :
Human PKIG full-length ORF ( NP_008997.1, 1 a.a. – 76 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
NP_008997.1

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=11142

Amino Acid Sequence :
MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPDKEAGNQPQSSDGTTSS

Molecular Weight :
34.3

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :
Mouse (90); Rat (90)

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,

Gene Name :
PKIG

Gene Alias :
MGC126458, MGC126459

Gene Description :
protein kinase (cAMP-dependent, catalytic) inhibitor gamma

Gene Summary :
The protein encoded by this gene is a member of the cAMP-dependent protein kinase (PKA) inhibitor family. Studies of a similar protein in mice suggest that this protein acts as a potent competitive PKA inhibitor, and is a predominant form of PKA inhibitors in various tissues. Three alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq

Other Designations :
OTTHUMP00000031722|OTTHUMP00000031723|OTTHUMP00000063215|OTTHUMP00000063216|OTTHUMP00000063217|OTTHUMP00000063219|PKI-gamma|cAMP-dependent protein kinase inhibitor gamma

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
PPT1 Protein
MAG/Siglec-4a Protein
Popular categories:
Galanin
Glucagon

Share this post on:

Author: calcimimeticagent