Name :
ICOSLG (Human) Recombinant Protein
Biological Activity :
Purified ICOSLG (AAH64637.1 18 a.a. – 135 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.Recombinant Human Protein,Recombinant Human Proteins,Human Recombinant Protein,Human Recombinant Proteins,HuPro
Tag :
Protein Accession No. :
AAH64637.1
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=23308
Amino Acid Sequence :
ADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVA
Molecular Weight :
18.26
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Human
Interspecies Antigen Sequence :
Mouse (46); Rat (55)
Preparation Method :
Transfection of pSuper-ICOSLG plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
Purification :
Strep-Tactin affinity columns
Quality Control Testing :
SDS-PAGE and Western Blot SDS-PAGE Gel Western Blot
Storage Buffer :
100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Applications :
Western Blot， Enzyme-linked Immunoabsorbent Assay， SDS-PAGE， Protein Interaction，
Gene Name :
ICOSLG
Gene Alias :
B7-H2, B7H2, B7RP-1, B7RP1, CD275, GL50, ICOS-L, ICOSL, KIAA0653, LICOS
Gene Description :
inducible T-cell co-stimulator ligand
Gene Summary :
Other Designations :
B7-like protein|OTTHUMP00000109524|transmembrane protein B7-H2 ICOS ligand
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
HAO1 Protein
PDGF-CC Protein
Popular categories:
Serine/Threonine Kinase 10
Parathyroid Hormone Receptor
