Name :
OR7C2 (Human) Recombinant Protein
Biological Activity :
Human OR7C2 full-length ORF (AAI41625.1) recombinant protein without tag.This product is belong to Proteoliposome (PL).Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength,Proteoliposome,Proteoliposomes,Membrane Protein,Membrane Proteins
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
AAI41625.1
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=26658
Amino Acid Sequence :
MERGNQTEVGNFLLLGFAEDSDMQLLLHGLFLSMYLVTIIGNLLIILTISSDSHLHTPMYFFLSNLSFADICFTSTTVPKMLVNIQTQSKMITFAGCLTQIFFFIAFGCLDNLLLTMTAYDRFVAICYPLHYTVIMNPRLCGLLVLGSWCISVMGSLLETLTILRLSFCTNMEIPHFFCDPSEVLKLACSDTFINNIVMYFVTIVLGVFPLCGILFSYSQIFSSVLRVSARGQHKAFSTCGSHLSVVSLFYGTGLGVYLSSAVTPPSRTSLAASVMYTMVTPMLNPFIYSLRNKDMKGSLGRLLLRATSLKEGTIAKLS
Molecular Weight :
35.09
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Mouse (71); Rat (72)
Preparation Method :
in vitro wheat germ expression system with proprietary liposome technology
Purification :
None
Quality Control Testing :
Storage Buffer :
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Applications :
Antibody Production,
Gene Name :
OR7C2
Gene Alias :
CIT-HSP-87M17, OR19-18, OR7C3
Gene Description :
olfactory receptor, family 7, subfamily C, member 2
Gene Summary :
Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq
Other Designations :
olfactory receptor OR19-22|olfactory receptor, family 7, subfamily C, member 3
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Klotho beta ProteinSpecies
TARC/CCL17 ProteinSource
Popular categories:
Carboxypeptidase D
Ubiquitin Conjugating Enzyme E2 M