Name :
SND1 (Human) Recombinant Protein (Q01)
Biological Activity :
Human SND1 partial ORF ( BAG35238.1, 791 a.a. – 885 a.a.) recombinant protein with GST-tag at N-terminal.
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
BAG35238.1
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=27044
Amino Acid Sequence :
SVVRDIQNTQCLLNVEHLSAGCPHVTLQFADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRADDADEFGYSR
Molecular Weight :
36.19
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Mouse (97); Rat (97)
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay， Western Blot (Recombinant protein)， Antibody Production， Protein Array，
Gene Name :
SND1
Gene Alias :
TDRD11, p100
Gene Description :
staphylococcal nuclease and tudor domain containing 1
Gene Summary :
Other Designations :
100 kDa coactivator|EBNA-2 co-activator (100kD)|EBNA2 coactivator p100|p100 EBNA2 co-activator|staphylococcal nuclease domain containing 1
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Neuroligin-3/NLGN3 Proteinmedchemexpress
LRRC32 ProteinMedChemExpress
Popular categories:
4-1BB/CD137
X-Linked Inhibitor Of Apoptosis (XIAP)
