Share this post on:

Name :
GLS2 (Human) Recombinant Protein (Q01)

Biological Activity :
Human GLS2 partial ORF ( NP_037399.2, 543 a.a. – 602 a.a.) recombinant protein with GST-tag at N-terminal.

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
NP_037399.2

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=27165

Amino Acid Sequence :
KVNPFAKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYTLSETQAEAAAEALSKENLESMV

Molecular Weight :
32.34

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :
Mouse (94); Rat (94)

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,

Gene Name :
GLS2

Gene Alias :
GA, GLS, LGA, MGC71567, hLGA

Gene Description :
glutaminase 2 (liver, mitochondrial)

Gene Summary :
The protein encoded by this gene is a mitochondrial phosphate-activated glutaminase that catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. This protein is functionally similar to the kidney glutaminase but is a little smaller in size. Originally thought to be liver-specific, this protein has been found in other tissues as well. At least one transcribed pseudogene has been found for this gene. [provided by RefSeq

Other Designations :
L-glutaminase|L-glutamine amidohydrolase|breast cell glutaminase|glutaminase 2|glutaminase GA|glutaminase I|glutaminase, liver|phosphate-activated glutaminase|phosphate-dependent glutaminase

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Kappa-Casein ProteinSynonyms
CCL4 Proteinsupplier
Popular categories:
Leukocyte Immunoglobulin Like Receptor B3/ILT-5
Signal Regulatory Protein Beta 1

Share this post on:

Author: calcimimeticagent