Share this post on:

Name :
CHRNA3 (Human) Recombinant Protein (Q01)

Biological Activity :
Human CHRNA3 partial ORF ( AAH00513, 32 a.a. – 141 a.a.) recombinant protein with GST-tag at N-terminal.

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
AAH00513

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=1136

Amino Acid Sequence :
SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALL

Molecular Weight :
37.84

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :
Rat (92)

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,

Gene Name :
CHRNA3

Gene Alias :
LNCR2, MGC104879, PAOD2

Gene Description :
cholinergic receptor, nicotinic, alpha 3

Gene Summary :
nicotinic

Other Designations :
Cholinergic receptor, neuronal nicotinic, alpha polypeptide-3|cholinergic receptor, nicotinic, alpha polypeptide 3|neuronal nicotinic acetylcholine receptor, alpha3 subunit

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
BCA-1/CXCL13 ProteinMolecular Weight
ATG4A Proteincustom synthesis
Popular categories:
CD96
JAK2

Share this post on:

Author: calcimimeticagent